Recombinant Human Small proline-rich protein 3(SPRR3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Small proline-rich protein 3(SPRR3)

CSB-EP022619HU
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q9UBC9

Gene Names: SPRR3

Organism: Homo sapiens (Human)

AA Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK

Expression Region: 2-169aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34 kDa

Alternative Name(s): 22KDA pancornulin Cornifin beta Esophagin

Relevance: Cross-linked envelope protein of keratinocytes.

Reference: "Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins." Gibbs S., Fijneman R., Wiegant J., Geurts van Kessel A., van de Putte P., Backendorf C.Genomics 16:630-637(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share