Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sialic acid-binding Ig-like lectin 6(SIGLEC6)

Recombinant Human Sialic acid-binding Ig-like lectin 6(SIGLEC6)

SKU:CSB-CF021300HU

Regular price $2,500.40 CAD
Regular price Sale price $2,500.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43699

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Protein Names:Recommended name: Sialic acid-binding Ig-like lectin 6 Short name= Siglec-6 Alternative name(s): CD33 antigen-like 1 CDw327 Obesity-binding protein 1 Short name= OB-BP1 CD_antigen= CD327

Gene Names:Name:SIGLEC6 Synonyms:CD33L, CD33L1, OBBP1

Expression Region:27-453

Sequence Info:full length protein

View full details