Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:A2A2V5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS
Protein Names:Recommended name: Serine-rich and transmembrane domain-containing protein 1
Gene Names:Name:SERTM1 Synonyms:C13orf36
Expression Region:1-107
Sequence Info:Full length protein