Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Serine protease hepsin(HPN)

Recombinant Human Serine protease hepsin(HPN)

SKU:CSB-CF010704HU

Regular price $2,108.40 CAD
Regular price Sale price $2,108.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P05981

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDR

Protein Names:Recommended name: Serine protease hepsin EC= 3.4.21.106 Alternative name(s): Transmembrane protease serine 1 Cleaved into the following 2 chains: 1. Serine protease hepsin non-catalytic chain 2. Serine protease hepsin catalytic chain

Gene Names:Name:HPN Synonyms:TMPRSS1

Expression Region:1-162

Sequence Info:full length protein

View full details