Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Scrapie-responsive protein 1(SCRG1)

Recombinant Human Scrapie-responsive protein 1(SCRG1)

SKU:CSB-YP530448HU

Regular price $989.81 CAD
Regular price Sale price $989.81 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: O75711

Gene Names: SCRG1

Organism: Homo sapiens (Human)

AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Expression Region: 21-98aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 10.9 kDa

Alternative Name(s): Scrapie-responsive gene 1 protein ;ScRG-1

Relevance:

Reference: Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details