Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Replication factor C subunit 1(RFC1), partial

Recombinant Human Replication factor C subunit 1(RFC1), partial

SKU:CSB-BP019588HU

Regular price $849.78 CAD
Regular price Sale price $849.78 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P35251

Gene Names: RFC1

Organism: Homo sapiens (Human)

AA Sequence: GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA

Expression Region: 402-492aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 13.8 kDa

Alternative Name(s): Activator 1 140KDA subunit

Relevance: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.

Reference: "Replication factor C interacts with the C-terminal side of proliferating cell nuclear antigen." Mossi R., Jonsson Z.O., Allen B.L., Hardin S.H., Huebscher U. J. Biol. Chem. 272:1769-1776(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details