Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)

Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)

SKU:CSB-EP009354HU

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P50395

Gene Names: GDI2

Organism: Homo sapiens (Human)

AA Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Expression Region: 1-445aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 66.7 kDa

Alternative Name(s): Guanosine diphosphate dissociation inhibitor 2 ;GDI-2

Relevance: Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th.

Reference: Asada M., Kaibuchi K., Takai Y. The human rab GDI beta gene with long retroposon-rich introns maps to 10p15 and its pseudogene to 7p11-p13.Sedlacek Z., Munstermann E., Mincheva A., Lichter P., Poutska A.Mamm. Genome 9:78-80(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details