Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative uncharacterized protein encoded by LINC00116(LINC00116)

Recombinant Human Putative uncharacterized protein encoded by LINC00116(LINC00116)

SKU:CSB-CF836719HU

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8NCU8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPP LNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWR KRRLQDKLAATQKKLDLA

Protein Names:Recommended name: Putative uncharacterized protein encoded by LINC00116

Gene Names:Name:LINC00116 Synonyms:NCRNA00116

Expression Region:1-138

Sequence Info:full length protein

View full details