Gene Bio Systems
Recombinant Human Putative uncharacterized protein encoded by LINC00116(LINC00116)
Recombinant Human Putative uncharacterized protein encoded by LINC00116(LINC00116)
SKU:CSB-CF836719HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8NCU8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPP LNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWR KRRLQDKLAATQKKLDLA
Protein Names:Recommended name: Putative uncharacterized protein encoded by LINC00116
Gene Names:Name:LINC00116 Synonyms:NCRNA00116
Expression Region:1-138
Sequence Info:full length protein
