Gene Bio Systems
Recombinant Human Putative selection and upkeep of intraepithelial T-cells protein 1 homolog(SKINT1)
Recombinant Human Putative selection and upkeep of intraepithelial T-cells protein 1 homolog(SKINT1)
SKU:CSB-CF427557HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:A8MVG2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEIRWFQSHYTRPVYLYKDGKDLYGETISKYVERTELLKEAIGEGKVTLRILNVSADDDG QYHCFFKDRNVYEESITEVKVTATSLEIQILIHPPNSKGLLVECNSEGWLPQPQMEWRES RGEIIPPASKSHSQDRNRLFTMKMSLLLRDSSHGNITCYLQNPVTGQEERTSIVLPDKLF PWNSIWILILVAILAVLLFFIMLPSVELQQREQRNWCD
Protein Names:Recommended name: Putative selection and upkeep of intraepithelial T-cells protein 1 homolog Short name= Skint-1
Gene Names:Name:SKINT1
Expression Region:1-218
Sequence Info:full length protein
