Gene Bio Systems
Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA(SLC7A5P2)
Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA(SLC7A5P2)
SKU:CSB-CF861932HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9GIP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIV VAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM LDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQ LIVHQPTQVI
Protein Names:Recommended name: Putative L-type amino acid transporter 1-like protein IMAA Alternative name(s): hLAT1 3-transmembrane protein IMAA Short name= hLAT1 3TM IMAA hLAT1 3-transmembrane protein MMAA Short name= hLAT1 3TM MMAA
Gene Names:Name:SLC7A5P2 Synonyms:IMAA, MMAA
Expression Region:1-190
Sequence Info:full length protein
