Recombinant Human Putative high affinity immunoglobulin gamma Fc receptor IC(FCGR1C)

SKU: CSB-CF008539HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NKC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWPLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGKGKHHYTSAGISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT

Protein Names:Recommended name: Putative high affinity immunoglobulin gamma Fc receptor IC Short name= IgG Fc receptor IC Alternative name(s): Fc-gamma RIC Short name= FcRIC Short name= hFcgammaRIC

Gene Names:Name:FCGR1C Synonyms:IGFRC

Expression Region:16-280

Sequence Info:full length protein