Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

CSB-YP021173HU
Regular price
$1,096.20 CAD
Sale price
$1,096.20 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: P07988

Gene Names: SFTPB

Organism: Homo sapiens (Human)

AA Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Expression Region: 201-279aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: NO-tagged

MW: 8.7 kDa

Alternative Name(s): 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Relevance: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Reference: "Conformational mapping of the N-terminal segment of surfactant protein B in lipid using 13C-enhanced Fourier transform infrared spectroscopy." Gordon L.M., Lee K.Y., Lipp M.M., Zasadzinski J.A., Walther F.J., Sherman M.A., Waring A.J. J. Pept. Res. 55:330-347(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share