Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q8IWL2
Gene Names: SFTPA1
Organism: Homo sapiens(Human)
AA Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Expression Region: 21-248aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
MW: 41.2 kDa
Alternative Name(s): Collectin-4
Relevance: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.
Reference: "Isolation and characterization of the human pulmonary surfactant apoprotein gene."White R.T., Damm D., Miller J., Spratt K., Schilling J., Hawgood S., Benson B., Cordell B.Nature 317:361-363(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.