Gene Bio Systems
Recombinant Human Protein tyrosine phosphatase receptor type C-associated protein(PTPRCAP)
Recombinant Human Protein tyrosine phosphatase receptor type C-associated protein(PTPRCAP)
SKU:CSB-CF618909HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q14761
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL HAFAGSAAWDDSARAAGGQGLHVTAL
Protein Names:Recommended name: Protein tyrosine phosphatase receptor type C-associated protein Short name= PTPRC-associated protein Alternative name(s): CD45-associated protein Short name= CD45-AP Lymphocyte phosphatase-associated phosphoprot
Gene Names:Name:PTPRCAP Synonyms:LPAP
Expression Region:1-206
Sequence Info:full length protein
