Recombinant Human Protein SSX4(SSX4)

Recombinant Human Protein SSX4(SSX4)

CSB-EP022736HU
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O60224

Gene Names: SSX4

Organism: Homo sapiens (Human)

AA Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Expression Region: 1-188aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 48.9 kDa

Alternative Name(s): Cancer/testis antigen 5.4

Relevance: Could act as a modulator of transcription.

Reference: "CD4+ T cell responses to SSX-4 in melanoma patients." Ayyoub M., Merlo A., Hesdorffer C.S., Rimoldi D., Speiser D., Cerottini J.C., Chen Y.T., Old L.J., Stevanovic S., Valmori D. J. Immunol. 174:5092-5099(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share