
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P26447
Gene Names: S100A4
Organism: Homo sapiens (Human)
AA Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Expression Region: 2-101aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 27.6 kDa
Alternative Name(s): Calvasculin;Metastasin;Placental calcium-binding protein;Protein Mts1S100 calcium-binding protein A4
Relevance:
Reference: Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.