Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein S100-A4(S100A4)

Recombinant Human Protein S100-A4(S100A4)

SKU:CSB-EP020632HU

Regular price $886.25 CAD
Regular price Sale price $886.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P26447

Gene Names: S100A4

Organism: Homo sapiens (Human)

AA Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Expression Region: 2-101aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.6 kDa

Alternative Name(s): Calvasculin;Metastasin;Placental calcium-binding protein;Protein Mts1S100 calcium-binding protein A4

Relevance:

Reference: Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details