Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: Q9UD71
Gene Names: PPP1R1B
Organism: Homo sapiens (Human)
AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Expression Region: 1-168aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 45.7 kDa
Alternative Name(s): DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein
Relevance: Inhibitor of protein-phosphatase 1.
Reference: "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.