Gene Bio Systems
Recombinant Human Protein JTB(JTB)
Recombinant Human Protein JTB(JTB)
SKU:CSB-CF011970HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O76095
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Protein Names:Recommended name: Protein JTB Alternative name(s): Jumping translocation breakpoint protein Prostate androgen-regulated protein Short name= PAR protein
Gene Names:Name:JTB ORF Names:HSPC222
Expression Region:31-146
Sequence Info:full length protein
