Recombinant Human Prostate stem cell antigen(PSCA)

SKU: CSB-YP018840HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Tags & Cell Markers

Uniprot ID: O43653

Gene Names: PSCA

Organism: Homo sapiens (Human)

AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Expression Region: 21-95aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 10.2 kDa

Alternative Name(s):

Relevance: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.1 Publication

Reference: "Reduced expression of PSCA, a member of the LY-6 family of cell surface antigens, in bladder, esophagus, and stomach tumors."Bahrenberg G., Brauers A., Joost H.G., Jakse G.Biochem. Biophys. Res. Commun. 275:783-788(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.