
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O43653
Gene Names: PSCA
Organism: Homo sapiens (Human)
AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Expression Region: 21-95a
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 12.2 kDa
Alternative Name(s):
Relevance: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.
Reference: Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M. , Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.