Recombinant Human Prostate stem cell antigen(PSCA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Prostate stem cell antigen(PSCA)

CSB-RP119074h
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O43653

Gene Names: PSCA

Organism: Homo sapiens (Human)

AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Expression Region: 21-95a

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.2 kDa

Alternative Name(s):

Relevance: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.

Reference: Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M. , Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share