
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P12273
Gene Names: PIP
Organism: Homo sapiens (Human)
AA Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Expression Region: 29-146aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
MW: 16 kDa
Alternative Name(s): Gross cystic disease fluid protein 15
Relevance:
Reference: "The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.