Gene Bio Systems
Recombinant Human Probable low affinity copper uptake protein 2(SLC31A2)
Recombinant Human Probable low affinity copper uptake protein 2(SLC31A2)
SKU:CSB-CF021577HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O15432
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLSTA
Protein Names:Recommended name: Probable low affinity copper uptake protein 2 Alternative name(s): Copper transporter 2 Short name= hCTR2 Solute carrier family 31 member 2
Gene Names:Name:SLC31A2 Synonyms:COPT2, CTR2
Expression Region:1-143
Sequence Info:Full length protein
