Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Post-GPI attachment to proteins factor 3(PGAP3)

Recombinant Human Post-GPI attachment to proteins factor 3(PGAP3)

SKU:CSB-CF856935HU

Regular price $2,312.80 CAD
Regular price Sale price $2,312.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96FM1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD

Protein Names:Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): COS16 homolog Short name= hCOS16 Gene coamplified with ERBB2 protein PER1-like domain-containing protein 1

Gene Names:Name:PGAP3 Synonyms:CAB2, PERLD1 ORF Names:UNQ546/PRO1100

Expression Region:21-320

Sequence Info:full length protein

View full details