![Recombinant Human Plasma kallikrein(KLKB1),partial](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_bf691685-3512-4f5f-949f-e05cfd1779d8_{width}x.jpg?v=1659193782)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cell Biology
Uniprot ID: P03952
Gene Names: KLKB1
Organism: Homo sapiens (Human)
AA Sequence: GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
Expression Region: 20-390aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 43.4 kDa
Alternative Name(s): Fletcher factor Kininogenin Plasma prekallikrein
Relevance: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Reference: "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats." Chung D.W., Fujikawa K., McMullen B.A., Davie E.W. Biochemistry 25:2410-2417(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.