Recombinant Human Plasma kallikrein(KLKB1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Plasma kallikrein(KLKB1),partial

CSB-YP012461HU
Regular price
$989.81 CAD
Sale price
$989.81 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: P03952

Gene Names: KLKB1

Organism: Homo sapiens (Human)

AA Sequence: GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR

Expression Region: 20-390aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 43.4 kDa

Alternative Name(s): Fletcher factor Kininogenin Plasma prekallikrein

Relevance: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.

Reference: "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats." Chung D.W., Fujikawa K., McMullen B.A., Davie E.W. Biochemistry 25:2410-2417(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share