Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated

SKU: Q9YID8

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9YID8

Gene Names: N/A

Alternative Name(s): (P1AB)(Virion protein 0)(P1C)(Virion protein 3)(P1D)(Virion protein 1)(P2A)(Protein 2A)(P2B)(P2C)(P3A)(VPg)(Protein 3B)(P3B)(P3C)(Picornain 3C)(P3D-POL)

Abbreviation: Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated

Organism: Human parechovirus 5 (strain CT86-6760) (HPeV-5) (Echovirus 23)

Source: E.coli

Expression Region: 1-290aa

Protein Length: Partial

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Target Protein Sequence: METIKSIADMATGFTNTIDSTVNAVTEGVSKIGNDSGGEILTKVADDASNLLGPNCVASTSQPENKDVVQATTTVNTLTNLTQHPSAPTMPFTPDFSNVDVFHSMAYDITTGDKNPSKLIRLDTTTWQHTWPRQHLINDVELPKAFWDKNSKPAYGQSRYFAAVRCGFHFQVQINVNQGTAGCALVVYEPKPIVTHGGHLEFGSYTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDLGRLRVYVWTPLTIPSSATNDVDVTVLGSLLQLDFQNPRTYDTDVNIYDN

MW: 79.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance between oxidative phosphorylation and aerobic glycolysis. The impact of TRAP1 on mitochondrial respiration is probably mediated by modulation of mitochondrial SRC and inhibition of SDHA.

Reference: "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309: 1559-1563(2005)

Function: