Recombinant Human p53-regulated apoptosis-inducing protein 1(TP53AIP1)

Recombinant Human p53-regulated apoptosis-inducing protein 1(TP53AIP1)

CSB-EP884624HU
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q9HCN2

Gene Names: TP53AIP1

Organism: Homo sapiens (Human)

AA Sequence: MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

Expression Region: 1-108aa

Sequence Info: Full Length of BC069399

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 38.3 kDa

Alternative Name(s):

Relevance: May play an important role in mediating p53/TP53-dependent apoptosis.

Reference: "p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53." Oda K., Arakawa H., Tanaka T., Matsuda K., Tanikawa C., Mori T., Nishimori H., Tamai K., Tokino T., Nakamura Y., Taya Y. Cell 102:849-862(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share