Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cell Biology
Uniprot ID: Q96FX8
Gene Names: PERP
Organism: Homo sapiens (Human)
AA Sequence: MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Expression Region: 1-193aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 41.4 kDa
Alternative Name(s): Keratinocyte-associated protein 1
Relevance: Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway
Reference: "p53 regulates the expression of a novel four transmembrane protein --PERP/PIGPC1 in mouse and human prostate cancer." Goltsov A.A., Ren C., Wang J., Yang G., Tahir S., Li L., Timme T.L., Thompson T.C. Submitted (OCT-2000)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.