Gene Bio Systems
Recombinant Human ORM1-like protein 1(ORMDL1)
Recombinant Human ORM1-like protein 1(ORMDL1)
SKU:CSB-CF868379HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9P0S3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
Protein Names:Recommended name: ORM1-like protein 1 Alternative name(s): Adoplin-1
Gene Names:Name:ORMDL1 ORF Names:HSPC202
Expression Region:1-153
Sequence Info:full length protein
