
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug
Updated Date: Stock Protein updated on 20171228
Research areas: Neuroscience
Target / Protein: OR1A1
Biologically active: Not Tested
Expression system: in vitro E.coli expression system
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q9P1Q5
AA Sequence: MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-309aa
Protein length: Full Length
MW: 50.6 kDa
Alternative Name(s): Olfactory receptor 17-7
Relevance: Odorant receptor.
Reference: "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2." Schmiedeberg K., Shirokova E., Weber H.P., Schilling B., Meyerhof W., Krautwurst D. J. Struct. Biol. 159:400-412(2007)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.