Recombinant Human Odorant-binding protein 2a (OBP2A) (C114S,K127N)

SKU: Q9NY56

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q9NY56

Gene Names: OBP2A

Alternative Name(s): Odorant-binding protein IIa Short name: OBPIIa

Abbreviation: Recombinant Human OBP2A protein (C114S,K127N)

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 16-170aa(C114S,K127N)

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Reference: "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."Lacazette E., Gachon A.-M., Pitiot G.Hum. Mol. Genet. 9: 289-301(2000)

Function: