
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: P30990
Gene Names: NTS
Organism: Homo sapiens (Human)
AA Sequence: SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK
Expression Region: 24-143aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 29.7 kDa
Alternative Name(s): NmN-125Neuromedin N ;NN ;NmNNeurotensin ;NTTail peptide
Relevance: Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Reference: Intermolecular interactions between the neurotensin and the third Extracellular domain loop of human neurotensin 1 receptor.Da Costa G., Bondon A., Coutant J., Curmi P., Monti J.P.J. Biomol. Struct. Dyn. 31:1381-1392(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.