Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

SKU:CSB-CF868343HU

Regular price $2,052.40 CAD
Regular price Sale price $2,052.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NX14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Alternative name(s): Complex I-ESSS Short name= CI-ESSS NADH-ubiquinone oxidoreductase ESSS subunit Neuronal protein 17.3 Short name=

Gene Names:Name:NDUFB11 ORF Names:UNQ111/PRO1064

Expression Region:30-153

Sequence Info:full length protein

View full details