Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13)

SKU:CSB-CF889167HU

Regular price $2,080.40 CAD
Regular price Sale price $2,080.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9P0J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQ IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLI GELYGLRTTEEALHASHGFMWYT

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Alternative name(s): Cell death regulatory protein GRIM-19 Complex I-B16.6 Short name= CI-B16.6 Gene associated with retinoic and interferon-induced mor

Gene Names:Name:NDUFA13 Synonyms:GRIM19 ORF Names:CDA016, CGI-39

Expression Region:2-144

Sequence Info:full length protein

View full details