Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)

SKU:CSB-CF801262HU

Regular price $2,076.20 CAD
Regular price Sale price $2,076.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86Y39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGRLEGWEVFAKPKV

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 Alternative name(s): Complex I-B14.7 Short name= CI-B14.7 NADH-ubiquinone oxidoreductase subunit B14.7

Gene Names:Name:NDUFA11

Expression Region:2-141

Sequence Info:full length protein

View full details