Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P60660
Gene Names: MYL6
Organism: Homo sapiens (Human)
AA Sequence: DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Expression Region: 3-151aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 43.7 kDa
Alternative Name(s): 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6
Relevance: Regulatory light chain of myosin. Does not bind calcium.
Reference: The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.Lenz S., Lohse P., Seidel U., Arnold H.H.J. Biol. Chem. 264:9009-9015(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.