Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myelin protein zero-like protein 3(MPZL3)

Recombinant Human Myelin protein zero-like protein 3(MPZL3)

SKU:CSB-CF740916HU

Regular price $2,170.00 CAD
Regular price Sale price $2,170.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6UWV2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPT TAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERG FGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEE EEACMARLCVRCAECLDSDYEETY

Protein Names:Recommended name: Myelin protein zero-like protein 3

Gene Names:Name:MPZL3 ORF Names:UNQ2966/PRO7425

Expression Region:32-235

Sequence Info:full length protein

View full details