Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P16455
Gene Names: MGMT
Organism: Homo sapiens (Human)
AA Sequence: MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Expression Region: 1-207aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 25.6 kDa
Alternative Name(s): 6-O-methylguanine-DNA methyltransferase ;MGMTO-6-methylguanine-DNA-alkyltransferase
Relevance: Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
Reference: Isolation and structural characterization of a cDNA clone encoding the human DNA repair protein for O6-alkylguanine.Tano K., Shiota S., Collier J., Foote R.S., Mitra S.Proc. Natl. Acad. Sci. U.S.A. 87:686-690(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.