Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P13640
Gene Names: MT1G
Organism: Homo sapiens (Human)
AA Sequence: MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCS
Expression Region: 1-59aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 32.9 kDa
Alternative Name(s): Metallothionein-1K ;MT-1KMetallothionein-IG ;MT-IG
Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Reference: Induction by zinc of specific metallothionein isoforms in human monocytes.Pauwels M., van Weyenbergh J., Soumillion A., Proost P., Ley M.Eur. J. Biochem. 220:105-110(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.