
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: Q9UHE8
Gene Names: STEAP1
Organism: Homo sapiens (Human)
AA Sequence: SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP
Expression Region: 3-69aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35 kDa
Alternative Name(s): Six-transmembrane epithelial antigen of prostate 1
Relevance: Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor .
Reference: The Steap proteins are metalloreductases.Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D.Blood 108:1388-1394(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.