Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Matrix metalloproteinase-20(MMP20)

Recombinant Human Matrix metalloproteinase-20(MMP20)

SKU:CSB-EP014667HU

Regular price $557.54 CAD
Regular price Sale price $557.54 CAD
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:O60882

Gene Names:MMP20

Organism:Homo sapiens (Human)

AA Sequence:YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC

Expression Region:108-483aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:47.6 kDa

Alternative Name(s):Enamel metalloproteinase (Enamelysin)

Relevance:Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein . May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.

Reference:"Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y. Nature 440:497-500(2006)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix

Involvement in disease:Amelogenesis imperfecta, hypomaturation type, 2A2 (AI2A2)

Subcellular Location:Secreted, extracellular space, extracellular matrix

Protein Families:Peptidase M10A family

Tissue Specificity:Expressed specifically in the enamel organ.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:7167

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=591946

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:9313

STRING Database Link:https://string-db.org/network/9606.ENSP00000260228

OMIM Database Link:https://www.omim.org/entry/604629604629604629

Lead Time Guidance:3-7 business days

View full details