Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Tags & Cell Markers
Uniprot ID: Q13296
Gene Names: SCGB2A2
Organism: Homo sapiens (Human)
AA Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Expression Region: 1-93aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35.5 kDa
Alternative Name(s): Mammaglobin-1 Secretoglobin family 2A member 2
Relevance:
Reference: "Mammaglobin, a mammary-specific member of the uteroglobin gene family, is overexpressed in human breast cancer." Watson M.A., Fleming T.P. Cancer Res. 56:860-865(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.