Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8),partial

SKU: CSB-EP844087HU1

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8NHS3

Gene Names: MFSD8

Organism: Homo sapiens (Human)

AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR

Expression Region: 1-40aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

MW: 34.8 kDa

Alternative Name(s): Ceroid-lipofuscinosis neuronal protein 7

Relevance: May be a carrier that transport small solutes by using chemiosmotic ion gradients

Reference: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.