Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b(FCGR2B)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b(FCGR2B)

SKU:CSB-CF008541HU

Regular price $2,265.20 CAD
Regular price Sale price $2,265.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P31994

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI

Protein Names:Recommended name: Low affinity immunoglobulin gamma Fc region receptor II-b Short name= IgG Fc receptor II-b Alternative name(s): CDw32 Fc-gamma RII-b Short name= Fc-gamma-RIIb Short name= FcRII-b CD_antigen= CD32

Gene Names:Name:FCGR2B Synonyms:CD32, FCG2, IGFR2

Expression Region:43-310

Sequence Info:full length protein

View full details