
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P06734
Gene Names: FCER2
Organism: Homo sapiens (Human)
AA Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Expression Region: 48-321aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 47 kDa
Alternative Name(s): BLAST-2;C-type lectin domain family 4 member JFc-epsilon-RIIImmunoglobulin E-binding factorLymphocyte IgE receptor; CD23
Relevance: Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Reference: Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia.Hersheson J., Mencacci N.E., Davis M., Macdonald N., Trabzuni D., Ryten M., Pittman A., Paudel R., Kara E., Fawcett K., Plagnol V., Bhatia K.P., Medlar A.J., Stanescu H.C., Hardy J., Kleta R., Wood N.W., Houlden H.Ann. Neurol. 73:546-553(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.