Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Lipoma HMGIC fusion partner-like 1 protein(LHFPL1)

Recombinant Human Lipoma HMGIC fusion partner-like 1 protein(LHFPL1)

SKU:CSB-CF774822HU

Regular price $2,164.40 CAD
Regular price Sale price $2,164.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86WI0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLA WQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPL GWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILV ESIMRNTNSYAMELDHCLKP

Protein Names:Recommended name: Lipoma HMGIC fusion partner-like 1 protein

Gene Names:Name:LHFPL1 ORF Names:UNQ5824/PRO19643

Expression Region:21-220

Sequence Info:full length protein

View full details