Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial

CSB-YP012937HU
Regular price
$855.20 CAD
Sale price
$855.20 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: A6NI73

Gene Names: LILRA5

Organism: Homo sapiens (Human)

AA Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Expression Region: 42-268aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 27.2 kDa

Alternative Name(s): CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like receptor 9 ;LIR-9; CD85f

Relevance: May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.

Reference: Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.Wende H., Volz A., Ziegler A.Immunogenetics 51:703-713(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share