
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: A6NI73
Gene Names: LILRA5
Organism: Homo sapiens (Human)
AA Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Expression Region: 42-268aa
Sequence Info: Extracellular Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 27.2 kDa
Alternative Name(s): CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like receptor 9 ;LIR-9; CD85f
Relevance: May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.
Reference: Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.Wende H., Volz A., Ziegler A.Immunogenetics 51:703-713(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.