Gene Bio Systems
Recombinant Human Kunitz-type protease inhibitor 2(SPINT2)
Recombinant Human Kunitz-type protease inhibitor 2(SPINT2)
SKU:CSB-CF022585HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O43291
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL
Protein Names:Recommended name: Kunitz-type protease inhibitor 2 Alternative name(s): Hepatocyte growth factor activator inhibitor type 2 Short name= HAI-2 Placental bikunin
Gene Names:Name:SPINT2 Synonyms:HAI2, KOP
Expression Region:28-252
Sequence Info:full length protein
