Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Signal Transduction
Uniprot ID: P20151
Gene Names: KLK2
Organism: Homo sapiens (Human)
AA Sequence: IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Expression Region: 25-261aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 30.2 kDa
Alternative Name(s): Glandular kallikrein-1
Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Reference: "Primary structure of a human glandular kallikrein gene." Schedlich L.J., Bennetts B.H., Morris B.J. DNA 6:429-437(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.