Gene Bio Systems
Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial(IDH3G)
Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial(IDH3G)
SKU:CSB-EP010993HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P51553
Gene Names: IDH3G
Organism: Homo sapiens (Human)
AA Sequence: FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
Expression Region: 40-393aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 54.8 kDa
Alternative Name(s): Isocitric dehydrogenase subunit gammaNAD(+)-specific ICDH subunit gamma
Relevance:
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
![Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial(IDH3G)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_65418da3-ae58-45db-93bd-7f11bb021d33.jpg?v=1659191055&width=1445)