Recombinant Human Interleukin-7(IL7)

Recombinant Human Interleukin-7(IL7)

CSB-CF011669HU
Regular price
$821.11 CAD
Sale price
$821.11 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Immunology

Uniprot ID: P13232

Gene Names: IL7

Organism: Homo sapiens(Human)

AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Expression Region: 26-177aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.4 kDa

Alternative Name(s):

Relevance: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.

Reference: "Characterization of the human and murine IL-7 genes."Lupton S.D., Gimpel S., Jerzy R., Brunton L.L., Hjerrild K.A., Cosman D., Goodwin R.G.J. Immunol. 144:3592-3601(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share